Lineage for d1gd8a_ (1gd8 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86243Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
  4. 86244Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
  5. 86245Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 86246Protein Prokaryotic ribosomal protein L17 [64265] (1 species)
  7. 86247Species Thermus thermophilus [TaxId:274] [64266] (1 PDB entry)
  8. 86248Domain d1gd8a_: 1gd8 A: [60445]

Details for d1gd8a_

PDB Entry: 1gd8 (more details), 2.3 Å

PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.

SCOP Domain Sequences for d1gd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd8a_ d.188.1.1 (A:) Prokaryotic ribosomal protein L17 {Thermus thermophilus}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOP Domain Coordinates for d1gd8a_:

Click to download the PDB-style file with coordinates for d1gd8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd8a_: