SCOPe 2.04: Domain d1gd7c_: 1gd7 C:

Lineage for d1gd7c_ (1gd7 C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein TRBP111 homolog CsaA [63770] (1 species)
   possesses export-related chaperone and tRNA-binding activities

7. Species Thermus thermophilus [TaxId:274] [63771] (1 PDB entry)

8. Domain d1gd7c_: 1gd7 C: [60443]

Details for d1gd7c_

PDB Entry: 1gd7, 2 Å

PDB Description: crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.

PDB Compounds: (C:) csaa protein

SCOPe Domain Sequences for d1gd7c_:

Sequence; same for both SEQRES and ATOM records:

>d1gd7c_ b.40.4.4 (C:) TRBP111 homolog CsaA {Thermus thermophilus [TaxId: 274]}
mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf

Timeline for d1gd7c_:

• d1gd7c_ first appeared in SCOP 1.57
  
• d1gd7c_ appears in SCOPe 2.03
  
• d1gd7c_ appears in SCOPe 2.05
  
• d1gd7c_ appears in the current release, SCOPe 2.08