Lineage for d1gd7a_ (1gd7 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541449Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1541486Protein TRBP111 homolog CsaA [63770] (1 species)
    possesses export-related chaperone and tRNA-binding activities
  7. 1541487Species Thermus thermophilus [TaxId:274] [63771] (1 PDB entry)
  8. 1541488Domain d1gd7a_: 1gd7 A: [60441]

Details for d1gd7a_

PDB Entry: 1gd7 (more details), 2 Å

PDB Description: crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.
PDB Compounds: (A:) csaa protein

SCOPe Domain Sequences for d1gd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd7a_ b.40.4.4 (A:) TRBP111 homolog CsaA {Thermus thermophilus [TaxId: 274]}
mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf

SCOPe Domain Coordinates for d1gd7a_:

Click to download the PDB-style file with coordinates for d1gd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd7a_: