Lineage for d1gd7a_ (1gd7 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59542Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 59543Protein CsaA [63770] (1 species)
  7. 59544Species Thermus thermophilus [TaxId:274] [63771] (1 PDB entry)
  8. 59545Domain d1gd7a_: 1gd7 A: [60441]

Details for d1gd7a_

PDB Entry: 1gd7 (more details), 2 Å

PDB Description: crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.

SCOP Domain Sequences for d1gd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd7a_ b.40.4.4 (A:) CsaA {Thermus thermophilus}
mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf

SCOP Domain Coordinates for d1gd7a_:

Click to download the PDB-style file with coordinates for d1gd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd7a_: