Lineage for d1gd6a_ (1gd6 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252464Species Silkworm (Bombyx mori) [TaxId:7091] [64201] (1 PDB entry)
  8. 252465Domain d1gd6a_: 1gd6 A: [60440]

Details for d1gd6a_

PDB Entry: 1gd6 (more details), 2.5 Å

PDB Description: structure of the bombyx mori lysozyme
PDB Compounds: (A:)

SCOP Domain Sequences for d1gd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd6a_ d.2.1.2 (A:) Lysozyme {Silkworm (Bombyx mori)}
ktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindryw
cskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc

SCOP Domain Coordinates for d1gd6a_:

Click to download the PDB-style file with coordinates for d1gd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd6a_: