Lineage for d1gd5a_ (1gd5 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86257Fold d.189: PX domain [64267] (1 superfamily)
  4. 86258Superfamily d.189.1: PX domain [64268] (1 family) (S)
  5. 86259Family d.189.1.1: PX domain [64269] (1 protein)
  6. 86260Protein p47phox NADPH oxidase [64270] (1 species)
  7. 86261Species Human (Homo sapiens) [TaxId:9606] [64271] (1 PDB entry)
  8. 86262Domain d1gd5a_: 1gd5 A: [60439]

Details for d1gd5a_

PDB Entry: 1gd5 (more details)

PDB Description: solution structure of the px domain from human p47phox nadph oxidase

SCOP Domain Sequences for d1gd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd5a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens)}
gsmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemf
pieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldff
kvrpddlklp

SCOP Domain Coordinates for d1gd5a_:

Click to download the PDB-style file with coordinates for d1gd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gd5a_: