Lineage for d1gd5a_ (1gd5 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.189: PX domain [64267] (1 superfamily) Superfamily d.189.1: PX domain [64268] (1 family) 
Family d.189.1.1: PX domain [64269] (1 protein) Protein p47phox NADPH oxidase [64270] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64271] (1 PDB entry) 
Domain d1gd5a_: 1gd5 A: [60439]
Details for d1gd5a_
PDB Entry: 1gd5 (more details)
PDB Description: solution structure of the px domain from human p47phox nadph oxidase
SCOP Domain Sequences for d1gd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd5a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens)}
gsmgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemf
pieagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldff
kvrpddlklp
SCOP Domain Coordinates for d1gd5a_:
Click to download the PDB-style file with coordinates for d1gd5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gd5a_:
- d1gd5a_ is new in SCOP 1.57
- d1gd5a_ appears in SCOP 1.59
- d1gd5a_ appears in the current release, SCOPe 2.08, called d1gd5a1
View in 3D