Lineage for d1gd5a1 (1gd5 A:3-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005656Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 3005657Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 3005658Family d.189.1.1: PX domain [64269] (6 proteins)
    Pfam PF00787
  6. 3005662Protein p47phox NADPH oxidase [64270] (1 species)
  7. 3005663Species Human (Homo sapiens) [TaxId:9606] [64271] (3 PDB entries)
  8. 3005668Domain d1gd5a1: 1gd5 A:3-130 [60439]
    Other proteins in same PDB: d1gd5a2

Details for d1gd5a1

PDB Entry: 1gd5 (more details)

PDB Description: solution structure of the px domain from human p47phox nadph oxidase
PDB Compounds: (A:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1gd5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd5a1 d.189.1.1 (A:3-130) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]}
mgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpi
eagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkv
rpddlklp

SCOPe Domain Coordinates for d1gd5a1:

Click to download the PDB-style file with coordinates for d1gd5a1.
(The format of our PDB-style files is described here.)

Timeline for d1gd5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gd5a2