Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Vav N-terminal SH3 domain [63744] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries) |
Domain d1gcqc1: 1gcq C:595-659 [60436] Other proteins in same PDB: d1gcqa1, d1gcqa2, d1gcqb_, d1gcqc2 complexed to Grb2 SH3 domains complexed with mrd |
PDB Entry: 1gcq (more details), 1.68 Å
SCOPe Domain Sequences for d1gcqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcqc1 b.34.2.1 (C:595-659) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} pkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnr vhpyv
Timeline for d1gcqc1: