Lineage for d1gcqc1 (1gcq C:595-659)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2054086Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 2054087Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 2054088Domain d1gcqc1: 1gcq C:595-659 [60436]
    Other proteins in same PDB: d1gcqa1, d1gcqa2, d1gcqb_, d1gcqc2
    complexed to Grb2 SH3 domains
    complexed with mrd

Details for d1gcqc1

PDB Entry: 1gcq (more details), 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains
PDB Compounds: (C:) vav proto-oncogene

SCOPe Domain Sequences for d1gcqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcqc1 b.34.2.1 (C:595-659) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
pkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnr
vhpyv

SCOPe Domain Coordinates for d1gcqc1:

Click to download the PDB-style file with coordinates for d1gcqc1.
(The format of our PDB-style files is described here.)

Timeline for d1gcqc1: