Lineage for d1gcqc_ (1gcq C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120949Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 1120950Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 1120951Domain d1gcqc_: 1gcq C: [60436]
    Other proteins in same PDB: d1gcqa_, d1gcqb_
    complexed to Grb2 SH3 domains
    complexed with mrd

Details for d1gcqc_

PDB Entry: 1gcq (more details), 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains
PDB Compounds: (C:) vav proto-oncogene

SCOPe Domain Sequences for d1gcqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
pcnrvhpyv

SCOPe Domain Coordinates for d1gcqc_:

Click to download the PDB-style file with coordinates for d1gcqc_.
(The format of our PDB-style files is described here.)

Timeline for d1gcqc_: