Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Vav N-terminal SH3 domain [63744] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries) |
Domain d1gcpd_: 1gcp D: [60433] Other proteins in same PDB: d1gcpb2 |
PDB Entry: 1gcp (more details), 2.1 Å
SCOPe Domain Sequences for d1gcpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcpd_ b.34.2.1 (D:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv hpyvh
Timeline for d1gcpd_:
View in 3D Domains from other chains: (mouse over for more information) d1gcpa_, d1gcpb1, d1gcpb2, d1gcpc_ |