Lineage for d1gcpd_ (1gcp D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392861Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 2392862Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 2392867Domain d1gcpd_: 1gcp D: [60433]
    Other proteins in same PDB: d1gcpb2

Details for d1gcpd_

PDB Entry: 1gcp (more details), 2.1 Å

PDB Description: crystal structure of vav sh3 domain
PDB Compounds: (D:) vav proto-oncogene

SCOPe Domain Sequences for d1gcpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcpd_ b.34.2.1 (D:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
hpyvh

SCOPe Domain Coordinates for d1gcpd_:

Click to download the PDB-style file with coordinates for d1gcpd_.
(The format of our PDB-style files is described here.)

Timeline for d1gcpd_: