Lineage for d1gcpd_ (1gcp D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165610Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 165611Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 165616Domain d1gcpd_: 1gcp D: [60433]

Details for d1gcpd_

PDB Entry: 1gcp (more details), 2.1 Å

PDB Description: crystal structure of vav sh3 domain

SCOP Domain Sequences for d1gcpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcpd_ b.34.2.1 (D:) Vav N-terminal SH3 domain {Mouse (Mus musculus)}
kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
hpyvh

SCOP Domain Coordinates for d1gcpd_:

Click to download the PDB-style file with coordinates for d1gcpd_.
(The format of our PDB-style files is described here.)

Timeline for d1gcpd_: