Lineage for d1gcpc_ (1gcp C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109522Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 109523Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 109527Domain d1gcpc_: 1gcp C: [60432]

Details for d1gcpc_

PDB Entry: 1gcp (more details), 2.1 Å

PDB Description: crystal structure of vav sh3 domain

SCOP Domain Sequences for d1gcpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcpc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus)}
kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
hpyvh

SCOP Domain Coordinates for d1gcpc_:

Click to download the PDB-style file with coordinates for d1gcpc_.
(The format of our PDB-style files is described here.)

Timeline for d1gcpc_: