Lineage for d1gcpb_ (1gcp B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783773Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 1783774Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 1783777Domain d1gcpb_: 1gcp B: [60431]

Details for d1gcpb_

PDB Entry: 1gcp (more details), 2.1 Å

PDB Description: crystal structure of vav sh3 domain
PDB Compounds: (B:) vav proto-oncogene

SCOPe Domain Sequences for d1gcpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcpb_ b.34.2.1 (B:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
mpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcn
rvhpyvh

SCOPe Domain Coordinates for d1gcpb_:

Click to download the PDB-style file with coordinates for d1gcpb_.
(The format of our PDB-style files is described here.)

Timeline for d1gcpb_: