Lineage for d1gc4d_ (1gc4 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895228Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2895408Species Thermus thermophilus [TaxId:274] [53391] (9 PDB entries)
  8. 2895438Domain d1gc4d_: 1gc4 D: [60428]
    complexed with asp, plp; mutant

Details for d1gc4d_

PDB Entry: 1gc4 (more details), 3.3 Å

PDB Description: thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate
PDB Compounds: (D:) aspartate aminotransferase

SCOPe Domain Sequences for d1gc4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc4d_ c.67.1.1 (D:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]}
mrglsrrvqamkpdavvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
rlsyatseenlrkalerfarvl

SCOPe Domain Coordinates for d1gc4d_:

Click to download the PDB-style file with coordinates for d1gc4d_.
(The format of our PDB-style files is described here.)

Timeline for d1gc4d_: