Lineage for d1gc3h_ (1gc3 H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2502822Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2502882Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2503062Species Thermus thermophilus [TaxId:274] [53391] (9 PDB entries)
  8. 2503088Domain d1gc3h_: 1gc3 H: [60424]
    complexed with plp, trp; mutant

Details for d1gc3h_

PDB Entry: 1gc3 (more details), 3.3 Å

PDB Description: thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan
PDB Compounds: (H:) aspartate aminotransferase

SCOPe Domain Sequences for d1gc3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc3h_ c.67.1.1 (H:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]}
mrglsrrvqamkpdavvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
rlsyatseenlrkalerfarvl

SCOPe Domain Coordinates for d1gc3h_:

Click to download the PDB-style file with coordinates for d1gc3h_.
(The format of our PDB-style files is described here.)

Timeline for d1gc3h_: