Lineage for d1gc3g_ (1gc3 G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147073Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2147133Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 2147290Species Thermus thermophilus [TaxId:274] [53391] (9 PDB entries)
  8. 2147315Domain d1gc3g_: 1gc3 G: [60423]
    complexed with plp, trp; mutant

Details for d1gc3g_

PDB Entry: 1gc3 (more details), 3.3 Å

PDB Description: thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan
PDB Compounds: (G:) aspartate aminotransferase

SCOPe Domain Sequences for d1gc3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc3g_ c.67.1.1 (G:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]}
mrglsrrvqamkpdavvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
rlsyatseenlrkalerfarvl

SCOPe Domain Coordinates for d1gc3g_:

Click to download the PDB-style file with coordinates for d1gc3g_.
(The format of our PDB-style files is described here.)

Timeline for d1gc3g_: