Lineage for d1gaja_ (1gaj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127048Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2127219Protein MJ1267 [64025] (1 species)
  7. 2127220Species Methanococcus jannaschii [TaxId:2190] [64026] (3 PDB entries)
  8. 2127222Domain d1gaja_: 1gaj A: [60416]
    complexed with cl, peg, so4, tbu

Details for d1gaja_

PDB Entry: 1gaj (more details), 2.5 Å

PDB Description: crystal structure of a nucleotide-free atp-binding cassette from an abc transporter
PDB Compounds: (A:) high-affinity branched chain amino acid transport ATP-binding protein

SCOPe Domain Sequences for d1gaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaja_ c.37.1.12 (A:) MJ1267 {Methanococcus jannaschii [TaxId: 2190]}
meilrtenivkyfgefkaldgvsisvnkgdvtliigpngsgkstlinvitgflkadegrv
yfenkditnkepaelyhygivrtfqtpqplkemtvlenlligeinpgesplnslfykkwi
pkeeemvekafkileflklshlydrkagelsggqmklveigralmtnpkmivmdqpiagv
apglahdifnhvlelkakgitfliiehrldivlnyidhlyvmfngqiiaegrgeeeiknv
lsdpkvveiyige

SCOPe Domain Coordinates for d1gaja_:

Click to download the PDB-style file with coordinates for d1gaja_.
(The format of our PDB-style files is described here.)

Timeline for d1gaja_: