SCOPe 2.07: Domain d1ga9a_: 1ga9 A:

Lineage for d1ga9a_ (1ga9 A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)

8. Domain d1ga9a_: 1ga9 A: [60414]
   complexed with etp, k, po4

Details for d1ga9a_

PDB Entry: 1ga9, 2.1 Å

PDB Description: crystal structure of ampc beta-lactamase from e. coli complexed with non-beta-lactamase inhibitor (2, 3-(4-benzenesulfonyl-thiophene-2-sulfonylamino)-phenylboronic acid)

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1ga9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ga9a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1ga9a_:

• d1ga9a_ first appeared in SCOP 1.57
  
• d1ga9a_ appears in SCOPe 2.06
  
• d1ga9a_ appears in the current release, SCOPe 2.08