SCOPe 2.07: Domain d1ga7b_: 1ga7 B:

Lineage for d1ga7b_ (1ga7 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein ADP-ribose pyrophosphatase [64365] (4 species)

7. Species Escherichia coli [TaxId:562] [64366] (5 PDB entries)

8. Domain d1ga7b_: 1ga7 B: [60413]
   complexed with gd3

Details for d1ga7b_

PDB Entry: 1ga7, 2.71 Å

PDB Description: crystal structure of the adp-ribose pyrophosphatase in complex with gd+3

PDB Compounds: (B:) hypothetical 23.7 kda protein in icc-tolc intergenic region

SCOPe Domain Sequences for d1ga7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ga7b_ d.113.1.1 (B:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
pvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaavllpfdp
vrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkpv
lsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkidn
aasvialqwlqlhhqalknewa

Timeline for d1ga7b_:

• d1ga7b_ first appeared in SCOP 1.57
  
• d1ga7b_ appears in SCOPe 2.06
  
• d1ga7b_ appears in the current release, SCOPe 2.08