Lineage for d1ga7a_ (1ga7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971452Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. 2971453Species Escherichia coli [TaxId:562] [64366] (5 PDB entries)
  8. 2971458Domain d1ga7a_: 1ga7 A: [60412]
    complexed with gd3
    has additional subdomain(s) that are not in the common domain

Details for d1ga7a_

PDB Entry: 1ga7 (more details), 2.71 Å

PDB Description: crystal structure of the adp-ribose pyrophosphatase in complex with gd+3
PDB Compounds: (A:) hypothetical 23.7 kda protein in icc-tolc intergenic region

SCOPe Domain Sequences for d1ga7a_:

Sequence, based on SEQRES records: (download)

>d1ga7a_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
mlkpdnlpvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaa
vllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagli
vkrtkpvlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwv
eegkidnaasvialqwlqlhhqalknewa

Sequence, based on observed residues (ATOM records): (download)

>d1ga7a_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
mlkpdnlpvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaa
vllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagli
vkrtkpvlsflaspggtserssimvgevdattasadenedirvhvvsreqayqwveegki
dnaasvialqwlqlhhqalknewa

SCOPe Domain Coordinates for d1ga7a_:

Click to download the PDB-style file with coordinates for d1ga7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ga7a_: