Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.2: Homing endonucleases [55608] (3 families) |
Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
Protein DNA endonuclease I-CreI [55610] (1 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries) Uniprot P05725 2-154 ! Uniprot P05725 |
Domain d1g9za_: 1g9z A: [60408] DNA product complex with magnesium protein/DNA complex; complexed with mg |
PDB Entry: 1g9z (more details), 1.8 Å
SCOPe Domain Sequences for d1g9za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9za_ d.95.2.1 (A:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk flevctwvdqiaalndsktrkttsetvravld
Timeline for d1g9za_: