Lineage for d1g9ya_ (1g9y A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82667Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
  4. 82673Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 82674Family d.95.2.1: Group I mobile intron endonuclease [55609] (2 proteins)
  6. 82675Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 82676Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (4 PDB entries)
  8. 82679Domain d1g9ya_: 1g9y A: [60406]

Details for d1g9ya_

PDB Entry: 1g9y (more details), 2.05 Å

PDB Description: homing endonuclease i-crei / dna substrate complex with calcium

SCOP Domain Sequences for d1g9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ya_ d.95.2.1 (A:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii}
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

SCOP Domain Coordinates for d1g9ya_:

Click to download the PDB-style file with coordinates for d1g9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g9yb_