Lineage for d1g9qb_ (1g9q B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136884Fold d.113: Nudix [55810] (1 superfamily)
  4. 136885Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 136886Family d.113.1.1: MutT-like [55812] (3 proteins)
  6. 136887Protein ADP-ribose pyrophosphatase [64365] (1 species)
  7. 136888Species Escherichia coli [TaxId:562] [64366] (3 PDB entries)
  8. 136892Domain d1g9qb_: 1g9q B: [60402]

Details for d1g9qb_

PDB Entry: 1g9q (more details), 2.3 Å

PDB Description: complex structure of the adpr-ase and its substrate adp-ribose

SCOP Domain Sequences for d1g9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9qb_ d.113.1.1 (B:) ADP-ribose pyrophosphatase {Escherichia coli}
pvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaavllpfdp
vrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkpv
lsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkidn
aasvialqwlqlhhqalknewa

SCOP Domain Coordinates for d1g9qb_:

Click to download the PDB-style file with coordinates for d1g9qb_.
(The format of our PDB-style files is described here.)

Timeline for d1g9qb_: