![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) |
![]() | Superfamily d.113.1: Nudix [55811] (2 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (3 proteins) |
![]() | Protein ADP-ribose pyrophosphatase [64365] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64366] (3 PDB entries) |
![]() | Domain d1g9qb_: 1g9q B: [60402] |
PDB Entry: 1g9q (more details), 2.3 Å
SCOP Domain Sequences for d1g9qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9qb_ d.113.1.1 (B:) ADP-ribose pyrophosphatase {Escherichia coli} pvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaavllpfdp vrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkpv lsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkidn aasvialqwlqlhhqalknewa
Timeline for d1g9qb_: