Lineage for d1g9oa_ (1g9o A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538577Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species)
  7. 1538578Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries)
  8. 1538579Domain d1g9oa_: 1g9o A: [60400]
    first PDZ domain

Details for d1g9oa_

PDB Entry: 1g9o (more details), 1.5 Å

PDB Description: first pdz domain of the human na+/h+ exchanger regulatory factor
PDB Compounds: (A:) nhe-rf

SCOPe Domain Sequences for d1g9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}
rmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpetdeql

SCOPe Domain Coordinates for d1g9oa_:

Click to download the PDB-style file with coordinates for d1g9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1g9oa_: