Lineage for d1g9la1 (1g9l A:6-144)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340459Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2340460Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2340461Family a.144.1.1: PABC (PABP) domain [63571] (3 protein domains)
  6. 2340465Protein poly(A) binding protein [63572] (3 species)
  7. 2340468Species Human (Homo sapiens) [TaxId:9606] [63573] (3 PDB entries)
  8. 2340471Domain d1g9la1: 1g9l A:6-144 [60399]
    Other proteins in same PDB: d1g9la2

Details for d1g9la1

PDB Entry: 1g9l (more details)

PDB Description: solution structure of the pabc domain of human poly(a) binding protein
PDB Compounds: (A:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d1g9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9la1 a.144.1.1 (A:6-144) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]}
aaaatpavrtvpqykyaagvrnpqqhlnaqpqvtmqqpavhvqgqepltasmlasappqe
qkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespeslrskvdeavavlqah
qakeaaqkavnsatgvptv

SCOPe Domain Coordinates for d1g9la1:

Click to download the PDB-style file with coordinates for d1g9la1.
(The format of our PDB-style files is described here.)

Timeline for d1g9la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g9la2