Lineage for d1g97a2 (1g97 A:2-251)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248321Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 248322Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 248368Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (2 proteins)
  6. 248369Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 248377Species Streptococcus pneumoniae [TaxId:1313] [64134] (5 PDB entries)
  8. 248380Domain d1g97a2: 1g97 A:2-251 [60395]
    Other proteins in same PDB: d1g97a1
    complexed with mg, na, ud1

Details for d1g97a2

PDB Entry: 1g97 (more details), 1.96 Å

PDB Description: s.pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+

SCOP Domain Sequences for d1g97a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
rinhkhmvng

SCOP Domain Coordinates for d1g97a2:

Click to download the PDB-style file with coordinates for d1g97a2.
(The format of our PDB-style files is described here.)

Timeline for d1g97a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g97a1