Lineage for d1g97a1 (1g97 A:252-447)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies) Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) 
Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domainProtein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species) Species Streptococcus pneumoniae [TaxId:1313] [63852] (2 PDB entries) 
Domain d1g97a1: 1g97 A:252-447 [60394]
Other proteins in same PDB: d1g97a2
Details for d1g97a1
PDB Entry: 1g97 (more details), 1.96 Å
PDB Description: s.pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+
SCOP Domain Sequences for d1g97a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae}
vsfvnpeatyididveiasevqieanvtlkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvivgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvignnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkde
SCOP Domain Coordinates for d1g97a1:
Click to download the PDB-style file with coordinates for d1g97a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g97a1:
- d1g97a1 is new in SCOP 1.57
- d1g97a1 appears in SCOP 1.59
- d1g97a1 appears in the current release, SCOPe 2.08
View in 3D
