SCOPe 2.08: Domain d1g97a1: 1g97 A:252-447

Lineage for d1g97a1 (1g97 A:252-447)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [63852] (5 PDB entries)

8. Domain d1g97a1: 1g97 A:252-447 [60394]
   Other proteins in same PDB: d1g97a2
   complexed with mg, na, ud1

Details for d1g97a1

PDB Entry: 1g97, 1.96 Å

PDB Description: s.pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+

PDB Compounds: (A:) n-acetylglucosamine-1-phosphate uridyltransferase

SCOPe Domain Sequences for d1g97a1:

Sequence; same for both SEQRES and ATOM records:

>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vsfvnpeatyididveiasevqieanvtlkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvivgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvignnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkde

Timeline for d1g97a1:

• d1g97a1 first appeared in SCOP 1.57
  
• d1g97a1 appears in SCOPe 2.07