Lineage for d1g95a2 (1g95 A:2-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133198Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (3 species)
  7. 2133214Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64134] (5 PDB entries)
  8. 2133222Domain d1g95a2: 1g95 A:2-251 [60392]
    Other proteins in same PDB: d1g95a1

Details for d1g95a2

PDB Entry: 1g95 (more details), 2.33 Å

PDB Description: crystal structure of s.pneumoniae glmu, apo form
PDB Compounds: (A:) n-acetylglucosamine-1-phosphate uridyltransferase

SCOPe Domain Sequences for d1g95a2:

Sequence, based on SEQRES records: (download)

>d1g95a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
rinhkhmvng

Sequence, based on observed residues (ATOM records): (download)

>d1g95a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknigeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrrrinhkh
mvng

SCOPe Domain Coordinates for d1g95a2:

Click to download the PDB-style file with coordinates for d1g95a2.
(The format of our PDB-style files is described here.)

Timeline for d1g95a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g95a1