Lineage for d1g90a_ (1g90 A:)
- Root: SCOP 1.57
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (3 superfamilies) Superfamily f.4.1: Outer membrane protein [56925] (1 family) 
Family f.4.1.1: Outer membrane protein [56926] (2 proteins) Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species) Species Escherichia coli [TaxId:562] [56928] (3 PDB entries) 
Domain d1g90a_: 1g90 A: [60388]
Details for d1g90a_
PDB Entry: 1g90 (more details)
PDB Description: nmr solution structure of outer membrane protein a transmembrane domain: 10 conformers
SCOP Domain Sequences for d1g90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g90a_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli}
apkdntwytgaklgfsqyhdtgfinnngpthenqlgagafggyqvnpyvgfemgydflgr
mpykgsvengaykaqgvqltaklgypitddldiytrlggmvfradtksnvygknhdtgvs
pvfaggveyaitpeiatrleyqftnnigdahtigtrpdngmlslgvsyrfgqgeaa
SCOP Domain Coordinates for d1g90a_:
Click to download the PDB-style file with coordinates for d1g90a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g90a_:
- d1g90a_ is new in SCOP 1.57
- d1g90a_ appears in SCOP 1.59
- d1g90a_ appears in the current release, SCOPe 2.08
View in 3D