Lineage for d1g8zh_ (1g8z H:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1313714Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1313715Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1313786Domain d1g8zh_: 1g8z H: [60387]
    complexed with gal; mutant

Details for d1g8zh_

PDB Entry: 1g8z (more details), 2 Å

PDB Description: his57ala mutant of cholera toxin b-penatmer
PDB Compounds: (H:) cholera toxin b protein

SCOPe Domain Sequences for d1g8zh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8zh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1g8zh_:

Click to download the PDB-style file with coordinates for d1g8zh_.
(The format of our PDB-style files is described here.)

Timeline for d1g8zh_: