SCOPe 2.02: Domain d1g8rb3: 1g8r B:178-326

Lineage for d1g8rb3 (1g8r B:178-326)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)

6. Protein MoeA, central domain [64104] (4 species)

7. Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)

8. Domain d1g8rb3: 1g8r B:178-326 [60382]
   Other proteins in same PDB: d1g8ra1, d1g8ra2, d1g8rb1, d1g8rb2
   complexed with gol

Details for d1g8rb3

PDB Entry: 1g8r, 2.65 Å

PDB Description: moea

PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1g8rb3:

Sequence; same for both SEQRES and ATOM records:

>d1g8rb3 c.57.1.2 (B:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

Timeline for d1g8rb3:

• d1g8rb3 first appeared in SCOP 1.57
  
• d1g8rb3 appears in SCOPe 2.01
  
• d1g8rb3 appears in SCOPe 2.03
  
• d1g8rb3 appears in the current release, SCOPe 2.08