![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
![]() | Domain d1g8rb2: 1g8r B:7-177 [60381] Other proteins in same PDB: d1g8ra1, d1g8ra3, d1g8rb1, d1g8rb3 complexed with gol |
PDB Entry: 1g8r (more details), 2.65 Å
SCOPe Domain Sequences for d1g8rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8rb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d1g8rb2: