![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) ![]() automatically mapped to Pfam PF03454 |
![]() | Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63870] (14 PDB entries) |
![]() | Domain d1g8rb1: 1g8r B:327-409 [60380] Other proteins in same PDB: d1g8ra2, d1g8ra3, d1g8rb2, d1g8rb3 complexed with gol |
PDB Entry: 1g8r (more details), 2.65 Å
SCOPe Domain Sequences for d1g8rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8rb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]} lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl erdrgnvevgewvevepfnalfg
Timeline for d1g8rb1: