SCOPe 2.02: Domain d1g8ra2: 1g8r A:7-177

Lineage for d1g8ra2 (1g8r A:7-177)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)

7. Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)

8. Domain d1g8ra2: 1g8r A:7-177 [60378]
   Other proteins in same PDB: d1g8ra1, d1g8ra3, d1g8rb1, d1g8rb3
   complexed with gol

Details for d1g8ra2

PDB Entry: 1g8r, 2.65 Å

PDB Description: moea

PDB Compounds: (A:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1g8ra2:

Sequence; same for both SEQRES and ATOM records:

>d1g8ra2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d1g8ra2:

• d1g8ra2 first appeared in SCOP 1.57
  
• d1g8ra2 appears in SCOPe 2.01
  
• d1g8ra2 appears in SCOPe 2.03
  
• d1g8ra2 appears in the current release, SCOPe 2.08