Lineage for d1g8pa_ (1g8p A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180170Protein ATPase subunit of magnesium chelatase, BchI [64040] (1 species)
  7. 180171Species Rhodobacter capsulatus [TaxId:1061] [64041] (1 PDB entry)
  8. 180172Domain d1g8pa_: 1g8p A: [60376]

Details for d1g8pa_

PDB Entry: 1g8p (more details), 2.1 Å

PDB Description: crystal structure of bchi subunit of magnesium chelatase
PDB Compounds: (A:)

SCOP Domain Sequences for d1g8pa_:

Sequence, based on SEQRES records: (download)

>d1g8pa_ c.37.1.13 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus}
rpvfpfsaivgqedmklallltavdpgiggvlvfgdrgtgkstavralaallpeieaveg
cpvsspnvemipdwatvlstnvirkptpvvdlplgvsedrvvgaldieraiskgekafep
gllaranrgylyidecnlledhivdllldvaqsgenvverdglsirhparfvlvgsgnpe
egdlrpqlldrfglsvevlsprdvetrvevirrrdtydadpkafleewrpkdmdirnqil
earerlpkveapntalydcaalcialgsdglrgeltllrsaralaalegatavgrdhlkr
vatmalshrlrrdpldeagstarvartveetlp

Sequence, based on observed residues (ATOM records): (download)

>d1g8pa_ c.37.1.13 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus}
rpvfpfsaivgqedmklallltavdpgiggvlvfgdrgtgkstavralaallpeieaveg
cpvsspnvemipdwatvlstnvirkptpvvdlplgvsedrvvgaldieraiskgekafep
gllaranrgylyidecnlledhivdllldvaqsgenvverdglsirhparfvlvgsgnpe
egdlrpqlldrfglsvevlsprdvetrvevirrrdtydadpkafleewrpkdmdirnqil
earerlpkveapntalydcaalcialgsdglrgeltllrsaralaalegatavgrdhlkr
vatmalshrlrvartveetlp

SCOP Domain Coordinates for d1g8pa_:

Click to download the PDB-style file with coordinates for d1g8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1g8pa_: