Lineage for d1g8oa_ (1g8o A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73507Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 73508Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 73619Family c.68.1.9: alpha-1,3-galactosyltransferase catalytic domain [64131] (1 protein)
  6. 73620Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 73621Species Cow (Bos taurus) [TaxId:9913] [64133] (3 PDB entries)
  8. 73623Domain d1g8oa_: 1g8o A: [60375]

Details for d1g8oa_

PDB Entry: 1g8o (more details), 2.3 Å

PDB Description: crystallographic structure of the native bovine alpha-1,3- galactosyltransferase catalytic domain

SCOP Domain Sequences for d1g8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8oa_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus)}
sklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryi
ehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdism
mrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndfty
errkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshl
nkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnn

SCOP Domain Coordinates for d1g8oa_:

Click to download the PDB-style file with coordinates for d1g8oa_.
(The format of our PDB-style files is described here.)

Timeline for d1g8oa_: