| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) ![]() |
| Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) |
| Protein MoeA, central domain [64104] (4 species) |
| Species Escherichia coli [TaxId:562] [64105] (14 PDB entries) |
| Domain d1g8lb3: 1g8l B:178-326 [60370] Other proteins in same PDB: d1g8la1, d1g8la2, d1g8lb1, d1g8lb2 complexed with gol |
PDB Entry: 1g8l (more details), 1.95 Å
SCOP Domain Sequences for d1g8lb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8lb3 c.57.1.2 (B:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg
Timeline for d1g8lb3: