| Class b: All beta proteins [48724] (174 folds) |
| Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() |
| Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
| Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
| Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
| Domain d1g8lb2: 1g8l B:7-177 [60369] Other proteins in same PDB: d1g8la1, d1g8la3, d1g8lb1, d1g8lb3 complexed with gol |
PDB Entry: 1g8l (more details), 1.95 Å
SCOPe Domain Sequences for d1g8lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8lb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d1g8lb2: