SCOP 1.67: Domain d1g8lb2: 1g8l B:7-177

Lineage for d1g8lb2 (1g8l B:7-177)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.103: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63882] (1 family)

5. Family b.103.1.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63883] (1 protein)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (2 species)

7. Species Escherichia coli [TaxId:562] [63885] (3 PDB entries)

8. Domain d1g8lb2: 1g8l B:7-177 [60369]
   Other proteins in same PDB: d1g8la1, d1g8la3, d1g8lb1, d1g8lb3
   complexed with gol

Details for d1g8lb2

PDB Entry: 1g8l, 1.95 Å

PDB Description: crystal structure of escherichia coli moea

SCOP Domain Sequences for d1g8lb2:

Sequence; same for both SEQRES and ATOM records:

>d1g8lb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d1g8lb2:

• d1g8lb2 first appeared in SCOP 1.57
  
• d1g8lb2 appears in SCOP 1.65
  
• d1g8lb2 appears in SCOP 1.69
  
• d1g8lb2 appears in the current release, SCOPe 2.08