Lineage for d1g8lb2 (1g8l B:7-177)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820804Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 2820805Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 2820809Domain d1g8lb2: 1g8l B:7-177 [60369]
    Other proteins in same PDB: d1g8la1, d1g8la3, d1g8lb1, d1g8lb3
    complexed with gol

Details for d1g8lb2

PDB Entry: 1g8l (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli moea
PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1g8lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8lb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d1g8lb2:

Click to download the PDB-style file with coordinates for d1g8lb2.
(The format of our PDB-style files is described here.)

Timeline for d1g8lb2: