SCOPe 2.05: Domain d1g8lb1: 1g8l B:327-409

Lineage for d1g8lb1 (1g8l B:327-409)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)

8. Domain d1g8lb1: 1g8l B:327-409 [60368]
   Other proteins in same PDB: d1g8la2, d1g8la3, d1g8lb2, d1g8lb3
   complexed with gol

Details for d1g8lb1

PDB Entry: 1g8l, 1.95 Å

PDB Description: crystal structure of escherichia coli moea

PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1g8lb1:

Sequence; same for both SEQRES and ATOM records:

>d1g8lb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

Timeline for d1g8lb1:

• d1g8lb1 first appeared in SCOP 1.57
  
• d1g8lb1 appears in SCOPe 2.04
  
• d1g8lb1 appears in SCOPe 2.06
  
• d1g8lb1 appears in the current release, SCOPe 2.08