Lineage for d1g8la3 (1g8l A:178-326)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703405Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 703406Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 703471Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 703479Protein MoeA, central domain [64104] (4 species)
  7. 703482Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)
  8. 703485Domain d1g8la3: 1g8l A:178-326 [60367]
    Other proteins in same PDB: d1g8la1, d1g8la2, d1g8lb1, d1g8lb2

Details for d1g8la3

PDB Entry: 1g8l (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli moea
PDB Compounds: (A:) molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1g8la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8la3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

SCOP Domain Coordinates for d1g8la3:

Click to download the PDB-style file with coordinates for d1g8la3.
(The format of our PDB-style files is described here.)

Timeline for d1g8la3: