SCOP 1.57: Domain d1g8la3: 1g8l A:178-236

Lineage for d1g8la3 (1g8l A:178-236)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.2: MoeA, central domain [64103] (1 protein)

6. Protein MoeA, central domain [64104] (1 species)

7. Species Escherichia coli [TaxId:562] [64105] (3 PDB entries)

8. Domain d1g8la3: 1g8l A:178-236 [60367]
   Other proteins in same PDB: d1g8la1, d1g8la2, d1g8lb1, d1g8lb2

Details for d1g8la3

PDB Entry: 1g8l, 1.95 Å

PDB Description: crystal structure of escherichia coli moea

SCOP Domain Sequences for d1g8la3:

Sequence; same for both SEQRES and ATOM records:

>d1g8la3 c.57.1.2 (A:178-236) MoeA, central domain {Escherichia coli}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraa

Timeline for d1g8la3:

• d1g8la3 is new in SCOP 1.57
  
• d1g8la3 appears in SCOP 1.59
  
• d1g8la3 appears in the current release, SCOPe 2.08