Class b: All beta proteins [48724] (176 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) automatically mapped to Pfam PF03453 |
Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
Domain d1g8la2: 1g8l A:7-177 [60366] Other proteins in same PDB: d1g8la1, d1g8la3, d1g8lb1, d1g8lb3 complexed with gol |
PDB Entry: 1g8l (more details), 1.95 Å
SCOPe Domain Sequences for d1g8la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8la2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d1g8la2: