Lineage for d1g8la2 (1g8l A:7-177)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64274Fold b.103: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63881] (1 superfamily)
  4. 64275Superfamily b.103.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63882] (1 family) (S)
  5. 64276Family b.103.1.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63883] (1 protein)
  6. 64277Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (1 species)
  7. 64278Species Escherichia coli [TaxId:562] [63885] (3 PDB entries)
  8. 64279Domain d1g8la2: 1g8l A:7-177 [60366]
    Other proteins in same PDB: d1g8la1, d1g8la3, d1g8lb1, d1g8lb3

Details for d1g8la2

PDB Entry: 1g8l (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli moea

SCOP Domain Sequences for d1g8la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8la2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOP Domain Coordinates for d1g8la2:

Click to download the PDB-style file with coordinates for d1g8la2.
(The format of our PDB-style files is described here.)

Timeline for d1g8la2: