SCOP 1.57: Domain d1g8la1: 1g8l A:237-409

Lineage for d1g8la1 (1g8l A:237-409)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.85: beta-clip [51268] (6 superfamilies)

4. Superfamily b.85.6: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63867] (1 family)

5. Family b.85.6.1: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63868] (1 protein)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (1 species)

7. Species Escherichia coli [TaxId:562] [63870] (3 PDB entries)

8. Domain d1g8la1: 1g8l A:237-409 [60365]
   Other proteins in same PDB: d1g8la2, d1g8la3, d1g8lb2, d1g8lb3

Details for d1g8la1

PDB Entry: 1g8l, 1.95 Å

PDB Description: crystal structure of escherichia coli moea

SCOP Domain Sequences for d1g8la1:

Sequence; same for both SEQRES and ATOM records:

>d1g8la1 b.85.6.1 (A:237-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli}
fieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcg
lpgnpvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrn
adgelevtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg

Timeline for d1g8la1:

• d1g8la1 is new in SCOP 1.57
  
• d1g8la1 appears in SCOP 1.59
  
• d1g8la1 appears in the current release, SCOPe 2.08