Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein) |
Protein ATP sulfurylase C-terminal domain [64012] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (7 PDB entries) |
Domain d1g8hb3: 1g8h B:390-511 [60362] Other proteins in same PDB: d1g8ha1, d1g8ha2, d1g8hb1, d1g8hb2 |
PDB Entry: 1g8h (more details), 2.8 Å
SCOP Domain Sequences for d1g8hb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8hb3 c.37.1.15 (B:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs gsgliipdqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff vf
Timeline for d1g8hb3: