SCOP 1.57: Domain d1g8hb3: 1g8h B:390-511

Lineage for d1g8hb3 (1g8h B:390-511)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)

6. Protein ATP sulfurylase C-terminal domain [64012] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (3 PDB entries)

8. Domain d1g8hb3: 1g8h B:390-511 [60362]
   Other proteins in same PDB: d1g8ha1, d1g8ha2, d1g8hb1, d1g8hb2

Details for d1g8hb3

PDB Entry: 1g8h, 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8hb3:

Sequence; same for both SEQRES and ATOM records:

>d1g8hb3 c.37.1.15 (B:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipdqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf

Timeline for d1g8hb3:

• d1g8hb3 is new in SCOP 1.57
  
• d1g8hb3 appears in SCOP 1.59
  
• d1g8hb3 appears in the current release, SCOPe 2.08